Protein Info for GFF2327 in Xanthobacter sp. DMC5

Annotation: Hydroxyacylglutathione hydrolase GloB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 6 to 255 (250 residues), 291.2 bits, see alignment E=3e-91 PF00753: Lactamase_B" amino acids 21 to 171 (151 residues), 62.6 bits, see alignment E=5.1e-21 PF16123: HAGH_C" amino acids 172 to 255 (84 residues), 96.1 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 56% identical to GLO2_NITHX: Hydroxyacylglutathione hydrolase (gloB) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 83% identity to xau:Xaut_2019)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF2327 Hydroxyacylglutathione hydrolase GloB (Xanthobacter sp. DMC5)
VPADIRLIPCLSDNYAVLIHDPVTEATAVVDVPEPGPVMTALEKEGWTLTHILVTHHHAD
HTQGITAVKARYGATVVGPKSEADKIPGLDVAVVDGDPVAVGSLVGRVLETPGHTAGPAS
YFFEGEKLLFAGDTLFTLGCGRALECDPPVLWHSLQRLRALPEDLDVYSGHEYTLGNGRF
ALSVDPDNVDLAAMYAKAQEQRAKGEPTMPSKLGDELKANPFLRSDDPAMAERLGMPGAD
PAEVFTELRERKNSFKG