Protein Info for GFF232 in Xanthobacter sp. DMC5

Annotation: Beta-barrel assembly-enhancing protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 98 to 118 (21 residues), see Phobius details PF01435: Peptidase_M48" amino acids 18 to 212 (195 residues), 89 bits, see alignment E=1.3e-28 PF13432: TPR_16" amino acids 263 to 327 (65 residues), 43.7 bits, see alignment E=1e-14 amino acids 343 to 383 (41 residues), 17.7 bits, see alignment 1.4e-06 PF14559: TPR_19" amino acids 303 to 370 (68 residues), 28.2 bits, see alignment E=6.7e-10

Best Hits

KEGG orthology group: None (inferred from 87% identity to xau:Xaut_3498)

Predicted SEED Role

"Putative Zn-dependent protease, contains TPR repeats"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF232 Beta-barrel assembly-enhancing protease (Xanthobacter sp. DMC5)
VPQKGPQTIQDTEIEALLKDYTRPILKAAGLAQQNVEVVLISSRAFNAFVADGRRIFVNT
GALVDSVTPNQIIGVLAHETGHIAGGHLARMREQIAGAQTMAIVAMLLAAGGVAAGAASG
MNGRDVGNVGAAAVSAPQEMIRRSLLSYQRGEESAADRSAVKYLNATGQSAKGMLETFER
FQNDQLFISQRVDPYVLSHPMARERIGALEQLAKSSPYYQVKDPPALQARHDMMRAKLIG
FMERPEAVARRYPPSDTSMAAQYARAISAYRFGNVDSSIRQIDALIAREPSNPYFLELKG
QALLEAGRAGEAIAPLRKAVQMTNGAPLIRAMLGQALVQSGNQANTQEAIRELIQATQRD
PNSPSAWRSLALAYGRSGDTANADLASAQSYFASGDFKLGRELASRARMKFPQGSPGWLK
ADDLVNFKPPASAANQR