Protein Info for GFF2317 in Sphingobium sp. HT1-2

Annotation: RNA polymerase ECF-type sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF22029: PhyR_sigma2" amino acids 42 to 94 (53 residues), 47.7 bits, see alignment E=1.9e-16 PF04542: Sigma70_r2" amino acids 46 to 107 (62 residues), 47.6 bits, see alignment E=1.7e-16 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 47 to 189 (143 residues), 64.4 bits, see alignment E=4.9e-22 PF08281: Sigma70_r4_2" amino acids 136 to 186 (51 residues), 53.2 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 85% identity to sjp:SJA_C1-23330)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF2317 RNA polymerase ECF-type sigma factor (Sphingobium sp. HT1-2)
MALTTSVHAARATVETGVAAVDEGLNQAPREALSDGEFKRELAAVIPHLRAFGRSLSGNR
DTADDLVQETLLKAWAARARFQAGTNMRAWTFIILRNHYLSQMRRSRFRGDWDDLTADRL
LAAPAGQDKHVELSDMQRALLQLPQPQREALILVGAGGFAYEEAAEICGVAVGTIKSRVA
RGRAALEQILEEGALPSRRTQETTDTAVLDEIMDDVDRLSRGRISDNLVDHGAADDDGDD
DMGGKTAED