Protein Info for GFF2315 in Sphingobium sp. HT1-2

Annotation: FIG071646: Sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 19 to 462 (444 residues), 391.7 bits, see alignment E=5.7e-121 TIGR03013: sugar transferase, PEP-CTERM system associated" amino acids 46 to 462 (417 residues), 485.9 bits, see alignment E=1.4e-149 PF02397: Bac_transf" amino acids 273 to 456 (184 residues), 217.5 bits, see alignment E=5e-69

Best Hits

KEGG orthology group: None (inferred from 87% identity to sch:Sphch_1157)

Predicted SEED Role

"FIG071646: Sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF2315 FIG071646: Sugar transferase (Sphingobium sp. HT1-2)
MIRLFKHYVPHAVLLLGLLDFLLLIGAAEAGWILRAHQIGMDVEPIATRIGPLLSFAFAI
QTGMIAVGVYSPEALQSIRFAFARLLVAISLGVIFLSVMYFLLPGITLWRSNSLYAMGLA
MGLLLLARMLLGSLLGGEAFKRRLVVLGAGRRANRIRDLEQKRGAGFLVVGYIAMNDGDQ
VVEEAINRTAIYNMSDYVVRLNASEVVLALEERRNAIPMSDLLRIKTTGVHVNDLSTFLE
RETGRVDLDSVNPSWLIFSDGFSAGRRLSSIAKRIFDIIASSILLLLTGPIILFAALLVK
LDSRGPAFYRQQRVGLYGQEFWIVKLRTMRQDAEVKGQAVWAEKDDPRITRLGYWLRKLR
IDELPQSWTVLKGEMSFVGPRPERRQFVEDLEQHLRYYAERHMVKPGITGWAQINYPYGA
SIEDARHKLEYDLYYAKNYTPFLDLLILIQTVRVILWPDGAR