Protein Info for GFF2312 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13432: TPR_16" amino acids 70 to 125 (56 residues), 15.9 bits, see alignment 6.6e-06 amino acids 138 to 199 (62 residues), 33.4 bits, see alignment E=2.3e-11 amino acids 243 to 293 (51 residues), 21.2 bits, see alignment 1.5e-07 amino acids 430 to 483 (54 residues), 21.2 bits, see alignment 1.5e-07 PF14559: TPR_19" amino acids 143 to 207 (65 residues), 26.6 bits, see alignment E=2.9e-09 amino acids 243 to 296 (54 residues), 28.2 bits, see alignment 8.7e-10 amino acids 611 to 668 (58 residues), 30.2 bits, see alignment 2e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (671 amino acids)

>GFF2312 hypothetical protein (Sphingobium sp. HT1-2)
MRRSRLILLAGLALLLLALAGLWQWRVHEADGSAALARGLAALDAGDARTARIELMNAIR
GNPASLPARLGHARALVQLGDGAGAQADLLRARKLGASVGDTNGLLAQALLLQGDADGAL
RAVQAGEGKSAEAARVAARAWQAKGDNDAAQRAFDDALHLDPRAARTWIDLGRFRLMLGD
QAGAIAAADKALALAPGDPDALTLRGMLIRDQYGLVAALPWFERALDDHPNALAPLTEYA
ATLADAGRASRALSVSRRILALDPGNPRAWFLQAVIAARAGQIDLARTLLARTDGRLDGE
PATRLLRGVLHLSDGNAVLAADALGPLVAMQPDNRVARTLLARASYLTGDYAGTAATLAP
LVDRHDADPYVLTLAARAQEQLGDRAQADALLARASWPVRPSSDLLGGTNAVMTPPVDVA
TAADNIPYIRALLMQGRTAEAIDRAGLLARANPGAPAAHVVLGDALVAAGRPADAARSFE
AAANIRFDRNAALRLVAAWSAAGDPARALQLVRLFLTQNPMDVEMQRLAAGAAMQAHDWR
GALRLLQAVEAQTGGHDALLMADLARASLETGSPGKARLYAAQAYRLMPANPVTADIYGL
VLLRTDAKGPAAIDLLEKAVALAPQNPPFQLHLGQAYAAAGRKAEAKRALSRAAAAHFPD
RQQAVKALAAL