Protein Info for GFF231 in Sphingobium sp. HT1-2

Annotation: Autolysin sensor kinase (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details amino acids 36 to 39 (4 residues), see Phobius details transmembrane" amino acids 21 to 35 (15 residues), see Phobius details amino acids 48 to 72 (25 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details PF06580: His_kinase" amino acids 162 to 242 (81 residues), 94.2 bits, see alignment E=4.6e-31 PF02518: HATPase_c" amino acids 260 to 359 (100 residues), 45.6 bits, see alignment E=9e-16

Best Hits

KEGG orthology group: None (inferred from 88% identity to sjp:SJA_C1-29280)

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>GFF231 Autolysin sensor kinase (EC 2.7.3.-) (Sphingobium sp. HT1-2)
MSVHPLQPKPFFADKNRAFWNLQSLGWAGAFLLRGSSTIANGQPLSSLIPVLISTVTGYS
ATLLIAVAFRFLQKQRPILTWGASIVTVVAAAAMVAFIDAWVFSTQNKGSETAGLQLFLG
AFYLSMTLLGAWSALYYAINFYLTVEEQADQLLHLENQASSAQLAMLRYQLNPHFLFNTL
NSISTLVLLKETTRANAMLSRLSSFLRYTLINEPTAQVTIEQEIETLKLYLEIEKMRFED
RLRPSFDVHPSVAHARLPSLLLQPLVENAIKYAVTPKEEGAEISVSAQPAGENVRIVVSD
SGPGLNDGAMKPHIPVSEGTGVGLPNIRDRLIQAFGERQRFETRSTQSGFSVIIEIPLNM
DETSKVAA