Protein Info for PS417_11770 in Pseudomonas simiae WCS417
Annotation: pyruvate dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to ACOB_CUPNH: Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta (acoB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)
KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 87% identity to avn:Avin_41740)MetaCyc: 59% identical to acetoin:DCPIP oxidoreductase beta subunit (Syntrophotalea carbinolica DSM 2380)
RXN-9718 [EC: 2.3.1.190]
Predicted SEED Role
"Acetoin dehydrogenase E1 component beta-subunit (EC 1.2.4.-)" in subsystem Acetoin, butanediol metabolism (EC 1.2.4.-)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Butanoate metabolism
- Citrate cycle (TCA cycle)
- Glycolysis / Gluconeogenesis
- Lysine degradation
- Pyruvate metabolism
- Valine, leucine and isoleucine biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 1.2.4.-, 1.2.4.1
Use Curated BLAST to search for 1.2.4.- or 1.2.4.1 or 2.3.1.190
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U2W0 at UniProt or InterPro
Protein Sequence (339 amino acids)
>PS417_11770 pyruvate dehydrogenase (Pseudomonas simiae WCS417) MARKISYQQAINEALAQEMRRDQSVFIIGQDVSGGTGSPGEQDAWGGVLGVTKGLYPEFP ERVLDAPLSEVGYVGMAVGAATRGMRPVCELMFVDFIGCCLDQLLNQAAKFRYMFGGKTT TPLVIRAMYGAGLRAAAQHSQMLTSMWTHIPGLKVVCPATPYDAKGMLIQAIRDNDPVIF LEHKMLYSLQGEVPEELYTVPFGEANFVREGKDVTLVTYGRMVHIALEAAAQLARQGIDC EVLDLRTTSPLDQDSILESVEKTGRLVVIDESNPRCSMATDISALVAQQGFSFLRAPIQM VTAPHTPVPFSDALEDLYIPNAAKIEAAVLKIADKRTAA