Protein Info for PS417_11765 in Pseudomonas simiae WCS417

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF00676: E1_dh" amino acids 17 to 313 (297 residues), 313.4 bits, see alignment E=2.6e-97 PF13292: DXP_synthase_N" amino acids 124 to 179 (56 residues), 21.2 bits, see alignment E=3.1e-08

Best Hits

Swiss-Prot: 60% identical to ACOA_CUPNH: Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha (acoA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 81% identity to ppf:Pput_0594)

MetaCyc: 62% identical to acetoin:DCPIP oxidoreductase alpha subunit (Syntrophotalea carbinolica DSM 2380)
RXN-9718 [EC: 2.3.1.190]

Predicted SEED Role

"Acetoin dehydrogenase E1 component alpha-subunit (EC 1.2.4.-)" in subsystem Acetoin, butanediol metabolism (EC 1.2.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.-, 1.2.4.1

Use Curated BLAST to search for 1.2.4.- or 1.2.4.1 or 2.3.1.190

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAZ5 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PS417_11765 ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MSTHLSTDQLLHAYTVMRTIRDFEERLHVEFATGEIPGFVHLYAGQEASAAGVMAHLNDE
DCIASNHRGHGHCIAKGVDVFGMMAEIYGKKTGVCGGKGGSMHIADQEKGMLGANGIVGA
GAPLAAGAALASKLKGSQGVAVAFFGDGGSNEGAVFEAMNLASIMKLPCLFVAENNGYAE
ATGSGWSVACKDIAERAVGFGMPGVIVDGNDFFAVHAALGVAVERARKGDGPTLVEVKLS
RFYGHFEGDAQTYRGPDEVKNLRENADCLALFRQRCSAEGWLDAAQFERIDGEVAQLIED
AVRLAKSDPKPQAADLLSDVYVAYP