Protein Info for GFF2306 in Variovorax sp. SCN45

Annotation: Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 47 to 375 (329 residues), 246.5 bits, see alignment E=1.8e-77

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 87% identity to vpe:Varpa_5045)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>GFF2306 Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA (Variovorax sp. SCN45)
MDTTSSLYDLTPIAWLMAAGVLIALGPLLWVWRRNAGAGPARRLHALTVLTLFLTFDLTL
FGAFTRLTDSGLGCPDWPGCYGNASPHGARHEIAMAQSAQPTGPVTHGKAWVEMVHRYLA
TGVGVLILTLAGATWIVRRRQRRVPQPSSSSKDGDHHATLSAWWPAFTLVWVCLQGAFGA
LTVTWKLFPAIVTLHLLGAVVLLALLCIQAVHYRQAAAQRLPTALSPALRNGLIATTVLL
VLQIALGGWVSTNYAVLACTQFPTCQDSWWPPMNFAQGFEIWRHLGVTGEGQPLDFSALT
AIHYAHRLMAYAVFAALGVLAWRLRRIDTLKPQARWLAGLALLQLATGLGNVLLGWPLAA
AVLHTGGAAALAVVLTWALCESRRAVPEARLARASDNATGHDNNNQRKAAA