Protein Info for GFF2305 in Xanthobacter sp. DMC5

Annotation: Nucleoid-associated protein YbaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 103 (101 residues), 86.7 bits, see alignment E=5.1e-29 PF02575: YbaB_DNA_bd" amino acids 8 to 97 (90 residues), 115.1 bits, see alignment E=6.6e-38

Best Hits

Swiss-Prot: 73% identical to Y463_NITHX: Nucleoid-associated protein Nham_0463 (Nham_0463) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K09747, hypothetical protein (inferred from 92% identity to xau:Xaut_2167)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>GFF2305 Nucleoid-associated protein YbaB (Xanthobacter sp. DMC5)
MRDLMGMMKQAKELQERMQQMQAELETVEVDGASGGGLVSVRVTAKGECKAVRIDPSLVK
PDEVEILEDLIVAALGDARGKAERVMQEKMQSLTGGLALPPGLKLF