Protein Info for PS417_11735 in Pseudomonas simiae WCS417

Annotation: methionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 82 to 101 (20 residues), see Phobius details TIGR01328: methionine gamma-lyase" amino acids 9 to 396 (388 residues), 584.6 bits, see alignment E=4.4e-180 PF01053: Cys_Met_Meta_PP" amino acids 12 to 395 (384 residues), 477.1 bits, see alignment E=2.9e-147 PF06838: Met_gamma_lyase" amino acids 54 to 235 (182 residues), 33.2 bits, see alignment E=2.3e-12

Best Hits

Swiss-Prot: 78% identical to MEGL_PSEDM: L-methionine gamma-lyase (megL) from Pseudomonas deceptionensis

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 94% identity to pfs:PFLU2558)

MetaCyc: 78% identical to methionine gamma-lyase (Pseudomonas deceptionensis)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TN93 at UniProt or InterPro

Protein Sequence (411 amino acids)

>PS417_11735 methionine gamma-lyase (Pseudomonas simiae WCS417)
MNNKHNAFGFSTRAIHHGYDPKDHHGALVPPIYLSATFAFPTAEYGAACFAGEASGHFYT
RISNPTLALLESRMATLENGDAAVAFSSGMGAIAATFWTLLRPGDEVIVSQTLYGCTFAL
LHHGIGEFGIKVRHVDLTDLTALQAALTPATRMIYCETPANPNLRLVDIAAVAALAHQQP
NVTLVVDNTYCTPYLQRPLELGADVVVHSATKYLSGHGDITAGIAVSNQALAQRIRLQGL
KDLTGAVMSPQDASLLMRGLKTLALRMDRHCSNAQAVAEALQAHPAVQSVTYPGLRSFPQ
YELATQQMKMPGGMIAFELKGGIETGRRFMNALKLFTRAVSLGDAESLAQHPASMTHSTY
TPQERAAHGISEGLVRLSVGLEDVADLLADVQQALAKCTRTATRPSKLASF