Protein Info for GFF2300 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Autoinducer 2 (AI-2) modifying protein LsrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF03992: ABM" amino acids 14 to 89 (76 residues), 67.5 bits, see alignment E=4.6e-23

Best Hits

Swiss-Prot: 100% identical to LSRG_SALTY: (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase (lsrG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11530, autoinducer 2-degrading protein (inferred from 98% identity to sed:SeD_A4478)

MetaCyc: 80% identical to (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase (Escherichia coli K-12 substr. MG1655)
RXN-15216 [EC: 5.3.1.32]; RXN0-6720 [EC: 5.3.1.32]

Predicted SEED Role

"Autoinducer 2 (AI-2) modifying protein LsrG" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>GFF2300 Autoinducer 2 (AI-2) modifying protein LsrG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTVILFGIIRGLMMHVTLVEINVHDDKVEQFIDVFRQNHLGSIKEPGNLRFDVLQDPQVL
TRFYIYEAYVDEQAVAFHKTTPHYKTCVEQLEPLMTGPRTKKVFMGLMP