Protein Info for GFF2297 in Xanthobacter sp. DMC5

Annotation: Transcription termination/antitermination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 TIGR01953: transcription termination factor NusA" amino acids 10 to 347 (338 residues), 450.8 bits, see alignment E=2.7e-139 PF08529: NusA_N" amino acids 10 to 130 (121 residues), 134.4 bits, see alignment E=5.7e-43 PF00575: S1" amino acids 137 to 198 (62 residues), 28.1 bits, see alignment E=5.3e-10 PF13184: KH_5" amino acids 235 to 301 (67 residues), 103.9 bits, see alignment E=1e-33 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 370 to 419 (50 residues), 73.2 bits, see alignment 1.3e-24

Best Hits

Swiss-Prot: 53% identical to NUSA_RICCN: Transcription termination/antitermination protein NusA (nusA) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 94% identity to xau:Xaut_0295)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>GFF2297 Transcription termination/antitermination protein NusA (Xanthobacter sp. DMC5)
MVAVSANRLELLQIADAVAREKSIDRSIVIAAMEDAIAKAARSRYGQETDIHADINPRTG
ELRLARHLLVVDEVENTATEITLDGARRHNPAAQVGDTIADTLPPFDFGRIAAQSAKQVI
VQKVREAERDRQYDEYKDRIGDVLNGLVKRVEYGNVVVDLGRGEGILRRDELLPRETVKT
GDRIRAYIYDVRREPRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAK
IAVISRDQSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNPDIATFIVNALAPAEVVK
VVLDEDRERIEVVVPDAQLSLAIGRRGQNVRLATQLTGWDIDIMTEQEESERRQKEFAER
TKMFSEALDLDEMMGQLLTSEGFTSVEEIAYVPISELASIEGFDEDTAAELQSRALKHLA
EVEEALDARRKELGVEDEVKDVPGVTSKMLVAFGENDIKTVEDLAGCATDDLIGWSERKD
GETIRHAGALDGFEFSREDAEALIMQARVTAGWIEAEPEAEGEEAPAEDA