Protein Info for PS417_11710 in Pseudomonas simiae WCS417

Annotation: N(5)-hydroxyornithine transformylase PvdF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU2547)

MetaCyc: 80% identical to hydroxy-L-ornithine formylase (Pseudomonas aeruginosa PAO1)
RXN-11127

Predicted SEED Role

"Pyoverdine synthetase PvdF, N5-hydroxyornithine formyltransferase" in subsystem Siderophore Pyoverdine

MetaCyc Pathways

pyoverdine I biosynthesis (9/11 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TX08 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PS417_11710 N(5)-hydroxyornithine transformylase PvdF (Pseudomonas simiae WCS417)
MTKKNLVYVWSLRNAAADKAGQPVAYKDHERYMMSVLESLVGALNDTPLGEAYNLVGVVY
DDDEQNPRDQQLVSDYGFAYQPGRQWLYPADLRVQGRLVNDLLLSVPSTYRRLPRGSAEH
IAGKQDFERRLHDTLVELKADIVVLDGLLVILDELVRPGAPFARRIMNIHPGITRIESPY
ERRGAYATWNALYGARGLKVTDWATKATTPSAPLYLTGASFHYVDNGIDSGEVFHDVLKT
EISPEDTILELRWNNFNNSLFPALHEGLALLAQQGI