Protein Info for PS417_11705 in Pseudomonas simiae WCS417

Annotation: cyclic peptide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 5 to 549 (545 residues), 838.2 bits, see alignment E=1.5e-256 PF00664: ABC_membrane" amino acids 23 to 259 (237 residues), 49.1 bits, see alignment E=1e-16 PF00005: ABC_tran" amino acids 358 to 493 (136 residues), 98.8 bits, see alignment E=6.4e-32

Best Hits

KEGG orthology group: K06160, putative ATP-binding cassette transporter (inferred from 99% identity to pfs:PFLU2546)

MetaCyc: 77% identical to ABC-type myristoylated ferribactin transporter (Pseudomonas aeruginosa PAO1)
7.4.2.-

Predicted SEED Role

"PvdE, pyoverdine ABC export system, fused ATPase and permease components" in subsystem Siderophore Pyoverdine

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UK48 at UniProt or InterPro

Protein Sequence (550 amino acids)

>PS417_11705 cyclic peptide transporter (Pseudomonas simiae WCS417)
MTDPKRGAFNGLLALLRPFRTIVTVSVALGMAGGLAITLLLATINNALHSPQGMTQGVIL
TFAALCVLALVSSIISDIGTNYVGQRIIAALRKDLGEKVLSAPIGQIERYRSHRLIPVLT
HDVDTISDFSFAFTPLAIAATVTLGCLGYLAYLSVPMFLMMVVAIVIGSAVQFIAGGKGI
QGFDLARSHEDELQRYYNAIASGAKELRMHRPRRFRMNTHRIQETADRISDIQVRSVNIY
ILAKTFGSMLFFVVIGLALAMQAYNPNPDPTVITGFVLVLLYMKGPLEHLLGYLPVVGKA
KIAFGRISELSERFSSPEPHLLMDDSEAPTPIVNSLELRNVSYSPPAVEGSEPFHLGPIN
LNIAQGDIVFIVGENGSGKTTLIKLLLGLYPPQSGEILLNGEAVTDPERDDYRQLFTTVF
ADYYLFDDLVQGSATQSLDSATKYLERLEIAHKVSVKDGVFSTTDLSTGQRKRLALVNAW
LEERPVLVFDEWAADQDPAFRRIFYTELLPDLKRLGKTIIVISHDDRYFDIADQLVRLRA
GQVVHKMEPA