Protein Info for GFF2293 in Xanthobacter sp. DMC5

Annotation: tRNA pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 59 to 267 (209 residues), 239.7 bits, see alignment E=1.3e-75 PF01509: TruB_N" amino acids 80 to 228 (149 residues), 182.2 bits, see alignment E=7.9e-58 PF16198: TruB_C_2" amino acids 229 to 289 (61 residues), 43.8 bits, see alignment E=2.3e-15

Best Hits

Swiss-Prot: 62% identical to TRUB_BRADU: tRNA pseudouridine synthase B (truB) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 81% identity to xau:Xaut_0291)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>GFF2293 tRNA pseudouridine synthase B (Xanthobacter sp. DMC5)
MTVRATAEAAAEAAAEPIVESVVDTAVAAEAAEAPPAGDAPRPSREQDNRPRAPKRDLDG
WVLLDKPTGMTSTQAVAVVKRIFGAKKAGHAGTLDPLASGCLPIAFGEATKTVPYVMDGR
KTYRFTVRFGVETDTDDSEGKAVETSDLRPSDDEIIAALPTFRGEIMQVPPAYSALKIGG
ERAYDLAREGEEVKLEARPVTIFRIDLVERPDADHAVLEAECGKGTYVRAIARDLGRMLG
SRGHICQLRRACVGPFLEERLVPLDELRDRAEASEEALMDALDPVAVALEEIPQLNVTPQ
EAHRLRCGQSIILRGRDAPIVEGHVAVSCQGALIAIGDGENGEVFPHRVFNWGKSSGKSS
NRPPRRNR