Protein Info for GFF2293 in Sphingobium sp. HT1-2

Annotation: Inner membrane protein YbhL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 36 to 61 (26 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details PF01027: Bax1-I" amino acids 30 to 243 (214 residues), 193.3 bits, see alignment E=2.3e-61

Best Hits

Swiss-Prot: 43% identical to Y893_DEIRA: Uncharacterized protein DR_0893 (DR_0893) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K06890, (no description) (inferred from 84% identity to sjp:SJA_C1-12440)

Predicted SEED Role

"FIG005935: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>GFF2293 Inner membrane protein YbhL (Sphingobium sp. HT1-2)
MANWSDPRSDIAGFGSASAARSEAFDAGLRKYMLSVYNYMASGVLLTGIVALLFAQSGLA
YQVFAGPGILKYIVMFAPLAFVMVLSFGINKLSTFATQALYWAYAAVMGVSLSYIFLAYT
GTSIAQTFFATAAAFAGLSLFGYTTKKDLSGFGTFLIMGVVGLLVASLINIFLRSSMMDL
VISAVGVLLFAGLTAYDTQKIKSIYAYVAGTEMMGKSVVMGALNLYLDFINMFLFLLRLF
GDRR