Protein Info for GFF2286 in Sphingobium sp. HT1-2

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 PF02861: Clp_N" amino acids 4 to 128 (125 residues), 93.7 bits, see alignment E=6.2e-30 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 7 to 741 (735 residues), 1117.9 bits, see alignment E=0 PF00004: AAA" amino acids 218 to 350 (133 residues), 49.8 bits, see alignment E=2.9e-16 amino acids 499 to 614 (116 residues), 43.7 bits, see alignment E=2.3e-14 PF17871: AAA_lid_9" amino acids 357 to 457 (101 residues), 94 bits, see alignment E=3.1e-30 PF07724: AAA_2" amino acids 493 to 654 (162 residues), 203 bits, see alignment E=2e-63 PF00158: Sigma54_activat" amino acids 498 to 621 (124 residues), 21.3 bits, see alignment E=1.1e-07 PF07728: AAA_5" amino acids 499 to 615 (117 residues), 49.4 bits, see alignment E=2.9e-16 PF10431: ClpB_D2-small" amino acids 662 to 740 (79 residues), 79.5 bits, see alignment E=9.3e-26

Best Hits

Swiss-Prot: 67% identical to CLPA_RHOBL: ClpA homolog protein from Rhodobacter blasticus

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 94% identity to sjp:SJA_C1-12460)

MetaCyc: 60% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (773 amino acids)

>GFF2286 ATP-dependent Clp protease ATP-binding subunit ClpA (Sphingobium sp. HT1-2)
MPSFAAALETTLHNALTHASERKHEYATLEHLLLALIDDEHASKVMQACGVELGELADAV
TQYLDTELDSLKVEGASDPSPTSGFQRVVQRAILHVQSSGKDEVTGANVLVALFSERESY
AVYFLQQQDMSRLDAVSYISHGVGKGTPTPERQETKGAAEEEKKVQDGKGKKDSALEQFT
VNLNEKAERGKVDPLIGRSSEVDRTIQILCRRSKNNPLYVGDPGVGKTAIAEGLARKIVE
GEVPDVLKEAVIYSLDMGALLAGTRYRGDFEERLKAVVTELEKMPHAVLFIDEIHTVIGA
GATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQKIDVNEPSVED
TIKILTGLRTAFEEHHHVKYTPDAIKAAVELSARYINDRKLPDKAIDVIDEVGAMQMLVV
PSKRKKTITPKEIEAVIATMARIPPKTVSSDDKSVLESLTTDLKRVVFGQDQAIEVLSSA
IKLSRAGLRDPDKPIGNYLFSGPTGVGKTEVARQLATLLGIPLQRFDMSEYMERHSVSRL
IGAPPGYVGYDQGGLLTDAVDQQPHSVLLLDEIEKAHPDLFNILLQVMDNGRLTDHHGKT
VDFRNTILIMTTNAGASDMAKESIGFGELTREDVQEDAVKKLFTPEFRNRLDAIVPFGYL
PPEIVARVIDKFVLQLELQLADRDVHITLDEDAKAWLTKKGYDKLYGARPMGRLMQEKIK
QPLAEELLFGKLVHGGEVHVHMKDEALAFQITPAAPKKGGKKGGKAKTPEGTK