Protein Info for GFF2286 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Melibiose carrier protein, Na+/melibiose symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 8 to 442 (435 residues), 362.4 bits, see alignment E=1.5e-112 PF13347: MFS_2" amino acids 10 to 428 (419 residues), 342.7 bits, see alignment E=2.6e-106 PF07690: MFS_1" amino acids 28 to 366 (339 residues), 50.7 bits, see alignment E=1.3e-17

Best Hits

Swiss-Prot: 35% identical to YAGG_ECOLI: Putative glycoside/cation symporter YagG (yagG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to seg:SG3356)

Predicted SEED Role

"Melibiose carrier protein, Na+/melibiose symporter" in subsystem Melibiose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF2286 Melibiose carrier protein, Na+/melibiose symporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLSIVEKIGFGAGDMAINVVIIAMQLLLAYFYTDIYGLSAADVGVLFVVVRMIDAIIDP
AMGVLTDKLNTRWGRYRPWLLWFAIPFGFAVYLMFITPDMAYMAKLAWAYGTYILMTLVY
TAITIPYISMIGVITSDPVERLSANGYRFVMTKIAAFLVTIVVPMLAVWLGQGNKALGYQ
FSMGLMGAMGALLFIFCFLTTRERSEPEITSLSVGKQFKYLLRNDQWIILGVVILLLMCG
YVIRGSVAAYYAKYYLNGGDSLISPFLTTGVVASILAMIATTWITKFWDKIKMFRYTQII
TFILSALMYFSVGRENLVLAFAFYFLINFFCDMQMPVFWSSIAEAVDYGEKKTGLRVSGL
AFGGILFFQKFGMGIAGGILGFLLSHFGYQADVEQSARSLTGIALMMTLIPALFHLAVGL
LMKKYLINNEYYRDIQLALAQKQA