Protein Info for PS417_11630 in Pseudomonas simiae WCS417

Annotation: sodium:dicarboxylate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 46 to 70 (25 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 224 to 250 (27 residues), see Phobius details amino acids 268 to 276 (9 residues), see Phobius details amino acids 306 to 331 (26 residues), see Phobius details amino acids 339 to 387 (49 residues), see Phobius details amino acids 390 to 392 (3 residues), see Phobius details PF00375: SDF" amino acids 14 to 409 (396 residues), 360.3 bits, see alignment E=6.7e-112

Best Hits

Swiss-Prot: 50% identical to DCTA2_PSEA7: C4-dicarboxylate transport protein 2 (dctA2) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: None (inferred from 65% identity to mno:Mnod_0758)

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYQ9 at UniProt or InterPro

Protein Sequence (434 amino acids)

>PS417_11630 sodium:dicarboxylate symporter (Pseudomonas simiae WCS417)
MSSTTAKKPLYKDLTFQVIAAMFLGIAFGFLAPELAAGFKILGDIFLKLIKTAVAPLVFF
TVVHGIASAGDIKRVGKVGLRALIYFEVVSTIALAIGLLWGNLLQIGSGMHDAHPSSAAA
TAASAAVAKGHAPASTLDFIYGIFPDNFVGAFAGGQLLQVLVISVLFGFALLALKPERRE
VIEDGLNRISECFFEFINLIMKFAPLGAFGSVAYAVGSNGTAVLMSLANLVLMFYVGIAF
FICVVLGAVCRLSGFSLWRFLTYIKDEIFIVLGTASSESALPRLLQKLEKFGCSKQSVGL
VLPTGYAFNLDGTSIYMSLCVLFIANAYGVPLSWEQQLGIIAIMLVTSKGAAAVSGGSFV
VFAATVTAIGVLPAEGLALLFGVYRFMSMAIATCNTIGNSVATVVVSKWSGEFSQQTAQD
EYQRVLGRAAGAAL