Protein Info for GFF2279 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details PF11744: ALMT" amino acids 53 to 144 (92 residues), 31.3 bits, see alignment E=2.2e-11 PF04632: FUSC" amino acids 56 to 394 (339 residues), 51.6 bits, see alignment E=1.3e-17 PF06081: ArAE_1" amino acids 59 to 190 (132 residues), 30.5 bits, see alignment E=7.1e-11 PF13515: FUSC_2" amino acids 66 to 190 (125 residues), 70.1 bits, see alignment E=3.9e-23

Best Hits

KEGG orthology group: None (inferred from 65% identity to xau:Xaut_0309)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF2279 hypothetical protein (Xanthobacter sp. DMC5)
MPRQPNSPAEPPPAASPAAGPSEVAPEDATPEAASGVPTLRDRLSKVIALAHLKLALRAT
IAGIVTYLLAEQFALPNGYWAVLTAVLVVQATLGASLSVAIDRALGTLAGGVVGVAGAML
AGKSPLETLLVLSVALFIAAALAARSTSFKLAPVTVVIVMLAHPGDVAPWLSGLTRVAEI
ALGGVVGLLCAILILPERALGKMFPYCANALRLTAQLLDLGRGGLLGQGIDPSIIDRLNG
GARLALRAADLRLVEVRAEQAGRLTTQTDPAPVVRGARRLWHSAIILLRNADRPLDEPVA
GLVSATLTAATTALSAQMSAIADRLDGQPVADLATRADAASAAVAALEARVEELNAQGAF
GAVGAETLTALFSAVSACVHMRENLEELAARLAEVQGEAP