Protein Info for PS417_11615 in Pseudomonas simiae WCS417
Annotation: urea ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 36% identical to LPTB_HAEIN: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 93% identity to pba:PSEBR_a3687)Predicted SEED Role
"Urea ABC transporter, ATPase protein UrtE" in subsystem Urea decomposition
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U2T9 at UniProt or InterPro
Protein Sequence (229 amino acids)
>PS417_11615 urea ABC transporter ATP-binding protein (Pseudomonas simiae WCS417) MFKIDQLSCGYGQSQILHDLNLNVAKREIVAVMGRNGMGKTTLFKSLMGILPQWQGQVSV DGQDVSALETHERVARGIAYVPQGRMIFPSMTVLENIQTGLPASARGKVPEDLYALFPVL HDMQSRKGGNLSGGQQQQLAIARALATNPKVLLLDEPTEGIQPSIIKDIARTLKEIRNLR DLTIVVSEQVLSFTLDIADRFLVIEKGRFVIEETRDRVDEAMISRYLSV