Protein Info for GFF2278 in Sphingobium sp. HT1-2

Annotation: Peptide-methionine (S)-S-oxide reductase MsrA (EC 1.8.4.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 4 to 148 (145 residues), 187.6 bits, see alignment E=8.9e-60 PF01625: PMSR" amino acids 5 to 170 (166 residues), 217.9 bits, see alignment E=4.8e-69

Best Hits

Swiss-Prot: 68% identical to MSRA_ERWT9: Peptide methionine sulfoxide reductase MsrA (msrA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 85% identity to sch:Sphch_0229)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>GFF2278 Peptide-methionine (S)-S-oxide reductase MsrA (EC 1.8.4.11) (Sphingobium sp. HT1-2)
MAQEIATLAGGCFWCTEAVYQTLKGVESVQSGYIGGTKVDPTYEEVCTGNTGHAEAIRIA
FDPAVISYADLLDIFFATHNPTTLNRQGNDIGTQYRSAIFPHSAEQQAEALAGIARAQVD
QVDPVVTAIEADAPWYPAEDYHQKYWERVGDQNPYCMAVIPPKLAKLRKGFAARIEE