Protein Info for GFF2278 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 887 PF08238: Sel1" amino acids 50 to 85 (36 residues), 34.3 bits, see alignment (E = 2.4e-12) amino acids 128 to 155 (28 residues), 9.1 bits, see alignment (E = 0.00023) amino acids 158 to 187 (30 residues), 23.9 bits, see alignment (E = 4.7e-09) amino acids 229 to 262 (34 residues), 19.9 bits, see alignment (E = 8.9e-08) amino acids 265 to 299 (35 residues), 29.8 bits, see alignment (E = 6.7e-11) amino acids 302 to 336 (35 residues), 28.4 bits, see alignment (E = 1.8e-10) amino acids 338 to 371 (34 residues), 27.5 bits, see alignment (E = 3.5e-10) amino acids 373 to 408 (36 residues), 36.1 bits, see alignment (E = 6.8e-13) amino acids 410 to 442 (33 residues), 37.8 bits, see alignment (E = 1.9e-13) amino acids 449 to 479 (31 residues), 33.9 bits, see alignment (E = 3.3e-12) amino acids 482 to 515 (34 residues), 39.3 bits, see alignment (E = 6.8e-14) amino acids 518 to 552 (35 residues), 34.7 bits, see alignment (E = 1.8e-12) amino acids 553 to 588 (36 residues), 35.2 bits, see alignment (E = 1.3e-12) amino acids 590 to 624 (35 residues), 39.7 bits, see alignment (E = 4.9e-14) amino acids 630 to 660 (31 residues), 25.7 bits, see alignment (E = 1.3e-09) amino acids 662 to 696 (35 residues), 38.5 bits, see alignment (E = 1.2e-13) amino acids 698 to 731 (34 residues), 22.8 bits, see alignment (E = 1.1e-08) amino acids 734 to 768 (35 residues), 33.4 bits, see alignment (E = 4.7e-12) amino acids 774 to 800 (27 residues), 11.5 bits, see alignment (E = 3.9e-05)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (887 amino acids)

>GFF2278 hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MGAVQWQQGQREAVPALGTGSPDLERLRQQHESPEAYFQRQLDAAEQGDAEAQWRLAHAY
QSGYGTRKDARKAAQWMRRSADQGHPSAMTDVGVELFHAADPAGWQEAARLFSAAAAKGG
KSAVYNQALTLLEGKGAQKDTAAGLVLLERAAESGVVNAEFNLGSRYMHGEDVPQDGQKA
AFWLGRAHAQQHVWALVMLAVLHLDGTLMPKNGALALKLVQQGMDRGLPEAQFLKGWMLL
LGEGVPQDVNVGVRWIRQAAQQQVAAAQSVLASAYMLGLGVRQDARQALEWARKAADAGE
GSAQALIGTLYLEGSGVDKDLGQAVSWFRKAVEGGNPMGQWALGRLYATGVGVAKDETEA
ARLFREAADQGLAEAQAELGTALADGRGVAKDEAEAVRWYRRAAEQGHVEAQNDLGYRYW
EGLGVERDVAQAVHWFRKSAATGDATGKFNLGVPYERGEGVPRDYGEALRWYREAAEQGE
RRAMNNLGHLYEAGLGVKVDHVQAVRWYRQAAERGLATAQNNLADMYARGRGVSKDDAEA
VRWRRKAAEQGHAEAQDELGHAYSEGKGVQQDDTMAVTWFRKAAEQGYARGQNNLGRAYH
NGQGVERDYAQAAHWYRKAVEQNHAVATGNLGTLYRYGTGVTKDPERASQLLRQAADGGH
VSAMANLGTMYLNGEGIPRNEQEALRFFRLAADRGSAQGQWGLGYMFSMGWGVAKDQKEA
ARLYRLAGAQGQVAALNNLGYLHELGEGVPQDHTEAVRLYRQAFDRGYLWAGANLGEMMA
YGRGTPRDMAEAVRLNRLALEKDLSLAYRHFGAFHAEGLLAPQDLVLALALMTRAEHLDN
DEAIPLVKAYRERMTPEQIGQAEALLARMTDGPTSLKAMDDYLAGQR