Protein Info for PS417_11610 in Pseudomonas simiae WCS417

Annotation: urea ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR03411: urea ABC transporter, ATP-binding protein UrtD" amino acids 12 to 252 (241 residues), 379.7 bits, see alignment E=3.2e-118 PF00005: ABC_tran" amino acids 29 to 182 (154 residues), 110.9 bits, see alignment E=1.1e-35 PF12399: BCA_ABC_TP_C" amino acids 229 to 252 (24 residues), 37.9 bits, see alignment (E = 1.5e-13)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 94% identity to pba:PSEBR_a3688)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAW3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PS417_11610 urea ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MTAVGFEMKKPVLAIEGLTVSFDGFKAVDNLNLYIDRNEVRVVIGPNGAGKTTVLDLICG
KTRATSGSIQFDGQELTNMREYNIVRAGVGRKFQNPSIYENLTVFENLEMSYPAGRKVWG
ALFFKRNAQVIARVEEVAREIFLGDLLQQQADLLSHGQKQWLEIGMLLMQDPELLMLDEP
VAGMSVNERAQTAELLNRISQGRSVLVIEHDMEFVKSIAHKVTVLHQGKVLAEGSMASVQ
SNPKVIEVYLGH