Protein Info for PS417_11605 in Pseudomonas simiae WCS417

Annotation: urea ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 243 to 270 (28 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details TIGR03408: urea ABC transporter, permease protein UrtC" amino acids 29 to 347 (319 residues), 449.6 bits, see alignment E=4e-139 PF02653: BPD_transp_2" amino acids 37 to 337 (301 residues), 118.3 bits, see alignment E=1.7e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 89% identity to pba:PSEBR_a3689)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWZ8 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PS417_11605 urea ABC transporter permease (Pseudomonas simiae WCS417)
MKALDKLLGGQQNLIGIVLLALLILVVFPLTLDAFRLNMVGKYLTYAFVAVGLVLCWGYG
GILSLGQGVFFGVGGYCMAMFLKLEASDPESTKIQSTPGIPDFMDWNQITELPWLWQPFH
SFSFTLAAVIAVPVLLAFIIGMALFKRRVGDVYFSIVTQAIALILTVLIVGQQGLTGGVN
GITDLKTLLGWDLRTDSAKMILYFINAGLLFGCIFIGRFILASKLGRLLMAMRDKEERVR
FSGYDVASFKIFVFCVAAAFSAIGGAMFALQVGFMSPSFVGIVPSIEMVIFAAVGGRMSL
LGAVYGALLVNYGKTYFSESFPELWLYLMGGLFIAVVMYFPNGLAGLWDSHGRQALAKML
RRKPVAATPVNAPLTPKATSKILETQP