Protein Info for PS417_11600 in Pseudomonas simiae WCS417

Annotation: urea ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 13 to 304 (292 residues), 399.6 bits, see alignment E=5.3e-124 PF02653: BPD_transp_2" amino acids 16 to 290 (275 residues), 139.8 bits, see alignment E=4.9e-45

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 96% identity to pba:PSEBR_a3690)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UK33 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PS417_11600 urea ABC transporter permease (Pseudomonas simiae WCS417)
MEWLSEFGAIAAMQGFNGLSVFCVLLLMALGLAIIFGQMGVINMAHGEFLTIGAYTTYVC
SSLTAHFAPGFQPYYFFFAIALSFLVAGAIGWLVEWAMISRLYKRPLDTLLATWGLSLVM
QQTFRSVFGAREVSAEPPAWLMGSVNFTDAIEIPRNGLFMMALTLLLTAAIFLMLYRSRW
GLQVRATVQNRLMSRAVGINTRKVDRMTFALGCGVAGVAGAAFTTIGSTGPTAGSQYIVD
TFLVVVFGGAQSLFGTIASAFVIAQTQSLSEFFLSGSMAKVLTLSSVILILMLRPQGLFS
IKVRK