Protein Info for GFF2274 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Predicted rhamnogalacturonide-specific TRAP-type transporter, small transmembrane component RhiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 10 to 32 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details PF04290: DctQ" amino acids 23 to 153 (131 residues), 111.4 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: None (inferred from 99% identity to sed:SeD_A4451)

Predicted SEED Role

"Predicted rhamnogalacturonide-specific TRAP-type transporter, small transmembrane component RhiB" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>GFF2274 Predicted rhamnogalacturonide-specific TRAP-type transporter, small transmembrane component RhiB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNTFRKGLDLLLGAICCLVLAIMVGIACWQVVSRYILGVPSTLTEEMLRFLLVWVSMLGM
AFVAGQKQHISLTLLLDKVSPTIRGWWDIILQVIFIAFSIWVLIIGGLKISAISMLQISP
ALGIPMGKIYYALPCAGVLIILYGLLNIVDALKAIHSATDTTEHTLEKSHD