Protein Info for GFF2273 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Predicted rhamnogalacturonide-specific TRAP-type transporter, large transmembrane component RhiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 142 to 169 (28 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details amino acids 321 to 352 (32 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details PF06808: DctM" amino acids 13 to 424 (412 residues), 445.5 bits, see alignment E=9e-138 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 429 (408 residues), 389.1 bits, see alignment E=1.1e-120

Best Hits

Swiss-Prot: 48% identical to YGIK_SALTY: Uncharacterized protein YgiK (ygiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sec:SC3943)

Predicted SEED Role

"Predicted rhamnogalacturonide-specific TRAP-type transporter, large transmembrane component RhiC" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>GFF2273 Predicted rhamnogalacturonide-specific TRAP-type transporter, large transmembrane component RhiC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIDPIFASCTLIAVFVVLLAMGAPIGICIVIASFSTMMLVLPFDISMFATAQKMFSSLDS
FALLAVPFFVLSGVIMNSGGIAARLVNFAKLFTGKLPGSLSYTNIVGNMMFGAISGSAIA
ASTSIGGVMVPMSAREGYDRGFAAAVNIASAPTGMLIPPTTAFILYALASGGTSIAALFA
GGLVAGVLWGVGCMLVTLVVAKRRNYRVFFTVQKGMALKVAVEAIPSLLLIVIIVGGIVQ
GIFTAIEASAIAVVYTLLLTMVFYRTLKIKDLPSILLQTVVMTGVIMFLLATSSAMSFSM
SITNIPAALSDMILGISANKLVILLVITVFLLIIGAFMDIGPAILIFTPILLPIMAKLGV
DPVHFGIIMIYNLAIGTITPPVGSGLYVGASVGKVKVEEVIKPLLPFYGAIIGVLLLITY
IPEITLFLPRLLGIM