Protein Info for GFF2266 in Xanthobacter sp. DMC5

Annotation: 3-oxo-tetronate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF07005: SBD_N" amino acids 5 to 229 (225 residues), 244.4 bits, see alignment E=1.4e-76 PF17042: NBD_C" amino acids 260 to 419 (160 residues), 137.2 bits, see alignment E=7.9e-44

Best Hits

Swiss-Prot: 66% identical to OTNK_METRJ: 3-oxo-tetronate kinase (otnK) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: None (inferred from 66% identity to sme:SM_b20670)

Predicted SEED Role

"FIG00641944: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>GFF2266 3-oxo-tetronate kinase (Xanthobacter sp. DMC5)
MPLTLGVIADDYTGASDLANTLSKEGVRTVQTIGVPDAALALPDADAVVVSLKSRSIPAD
EAVAQSLAAYAWLKGRGASHILFKVCSTFDSTDDGNIGPVTDALRLATGAAIVPVTPAFP
ETGRTVYMGHLFVGDVPLNESPLKDHPLNPMTDSDLKRVLARQSAGRVGLVPLKDVAAGA
DAVSARLEKLALEGRTAAIVDAVFDRDLEAVGIAAAALPLSTGASGLGLGLARALIADGR
VLRQQSDGAALAAGIGGYAAVVAGSCSKATLEQIAIAEGQMPVLRLSAERLVTHPEAEVT
AALDWAKARLASGPVLIAASGAPEQVAEVQARFGRHAAGVAIEHGTAAISEGLVAAGVRR
LVLAGGETSGASVDRLKIPAFLVGPEIAPGVPLLRTEGQPGEPMVLALKSGNFGGPDFFA
KVLGMMGVG