Protein Info for PS417_11530 in Pseudomonas simiae WCS417

Annotation: amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 55 to 206 (152 residues), 64 bits, E=1e-21

Best Hits

KEGG orthology group: K08281, nicotinamidase/pyrazinamidase [EC: 3.5.1.- 3.5.1.19] (inferred from 75% identity to pfl:PFL_2466)

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

• aldoxime degradation (3/3 steps found)
• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD salvage pathway V (PNC V cycle) (3/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• NAD salvage (plants) (5/11 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.19

Sequence Analysis Tools

See U1TT40 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PS417_11530 amidase (Pseudomonas simiae WCS417)
MTLAKTAIASFDVDAQKSFTPLCPNELPVAGGDQIGAELNYMASLAGHRVGSKDAHTPHA
PWVVSQHSEMLQPTGLAHADVTWVSHCVPGTEGFTLLDALPTPYDYDYFIWKGVEPDLHP
YGACYHDLHDKLSTGVIEYLNAQGVTRVIVGGLALDYCVKTTALQLLKAGLEVILHLPAC
RGITEEGGVQAVNELLKAGAVISSTREELAAMAAR