Protein Info for GFF2261 in Sphingobium sp. HT1-2

Annotation: Potassium channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details PF07885: Ion_trans_2" amino acids 32 to 115 (84 residues), 50.6 bits, see alignment E=1.4e-17 PF02254: TrkA_N" amino acids 137 to 255 (119 residues), 86 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: None (inferred from 83% identity to sjp:SJA_C1-12680)

Predicted SEED Role

"Potassium channel protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF2261 Potassium channel protein (Sphingobium sp. HT1-2)
MKIAPPPSASPMAGFLRRRSALPVWADLAWRVVLVFGLIAIVLALHWFGRDGLKDNYDDQ
ISFIDVLYFTTVTVTTVGYGDIVPVSPEARLFESIFVTPIRLFVWIIFLGTAYNLFFRNI
LYRWRMARIQADLHNHIVVTGFGTSGQEAVNELLARGTDPREIVVIDGSEKALDHAEALG
CNVLCGDSTRDKTLKDVAIHRARTMIVSAGRDDTSILITLTARHLAPRLPISIVVRNEDN
EVPARQAGATTVINPVSFAGLLLAGSTSGKHIADYMADLAASGGRVKLHERPVLPQEIGQ
PLSAIGTGLGVRIYRGDHPIGFWEEGARALQTGDCIIEIVEETGATPRANDQ