Protein Info for GFF2259 in Xanthobacter sp. DMC5

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 79% identical to MURB_AZOC5: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 85% identity to xau:Xaut_0324)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
peptidoglycan recycling I (7/14 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF2259 UDP-N-acetylenolpyruvoylglucosamine reductase (Xanthobacter sp. DMC5)
MSMAETGGAAPAAFPDLLPALRPLLPELRGTLNANAPLADFAWFRVGGPAQLLFLPADAD
DLAYLLAHIPADLPVTVIGLGSNLIVRDGGVPGVVIRLGRGFTDVSVEGTRIIAGTGVPD
VKVARAAADAGLAGFSFLRGIPGAIGGALRMNGGAYGGETKDVLVEAEGVTRAGAKVRFT
NADMGFTYRHCGVPDDVIFTRAVFEGRPGDPAEIAAEMAKITESREATQPIKSRTGGSTF
KNPPGTSAWKLVDAAGCRGLTIGRAQVSELHTNFLINLGGATAAEIEGLGEEVRRRVKET
SGVTLEWEIKRIGLPLPPA