Protein Info for GFF2258 in Xanthobacter sp. DMC5

Annotation: D-alanine--D-alanine ligase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR01205: D-alanine--D-alanine ligase" amino acids 4 to 302 (299 residues), 273.4 bits, see alignment E=1.1e-85 PF01820: Dala_Dala_lig_N" amino acids 54 to 84 (31 residues), 41.6 bits, see alignment (E = 2.6e-14) PF02786: CPSase_L_D2" amino acids 96 to 271 (176 residues), 24 bits, see alignment E=3.8e-09 PF07478: Dala_Dala_lig_C" amino acids 123 to 300 (178 residues), 135.8 bits, see alignment E=2.2e-43

Best Hits

Swiss-Prot: 92% identical to DDL_XANP2: D-alanine--D-alanine ligase (ddl) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 92% identity to xau:Xaut_0325)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF2258 D-alanine--D-alanine ligase B (Xanthobacter sp. DMC5)
MAKHVAVLMGGWSSEREVSLNSGAACAAALEGAGYRVTPVDVGRDVAEVLARLKPDVVFN
VLHGAPGEDGTIQGILEILRIPYSHSGVLASALAMDKAQARIMLAAAGVPVAKGGLVSRA
AAAKAHAMERPYVLKPNTGGSSVGVFIVREDQEHPPQELTREDWTLGENLLVEEFIAGLE
LTCAVMGDKVFDVIEIESTQAFYDYESKYAPGGSRHILPARILPEIYQRVQMLSLTAHRA
LGCRGVSRSDFRFDPSKGDASGLVCLEVNTQPGMTRTSLVPELAAHAGISFGELVTWMVE
DASLDR