Protein Info for GFF2257 in Xanthobacter sp. DMC5

Annotation: Cell division protein FtsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 80 to 100 (21 residues), see Phobius details PF08478: POTRA_1" amino acids 123 to 191 (69 residues), 79 bits, see alignment E=2.6e-26 PF03799: FtsQ_DivIB_C" amino acids 195 to 309 (115 residues), 67.9 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 86% identity to xau:Xaut_0326)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF2257 Cell division protein FtsQ (Xanthobacter sp. DMC5)
MDGGGRVAGSLGPRPGAGRRPPQRPGAGYGARPDAAPRAPAPPPGRHKRLAIDTRPASRL
ALFLRRLSVRMSTSRLGRRSASLLAIAVIGGFSAYGTVLGGHVEEAKGIVIDVADAAGNL
AGFKVKEVNIAGHNHVTPAQILETAGIKSSTSILFLNADEMRARLEAMPWIASASVRKFY
PDRIEIAITERQAYALWQVNGEIKVIARDGIPIAPYSDDPRYVQLPIVVGEGAQNHVGEI
VDALARLPALKEQVRAAIFVAERRWTLKTRNGIDVRLPEENLEGALVALMDLDREKKLLS
RDITIVDLRLPDRVVVRQSDAAAAARAEMLKARAKAKKGGPA