Protein Info for GFF2254 in Xanthobacter sp. DMC5

Annotation: UDP-3-O-acyl-N-acetylglucosamine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase" amino acids 1 to 284 (284 residues), 302.9 bits, see alignment E=1.2e-94 PF03331: LpxC" amino acids 2 to 274 (273 residues), 331.6 bits, see alignment E=2e-103

Best Hits

Swiss-Prot: 54% identical to LPXC_BRUA1: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Brucella abortus (strain S19)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 86% identity to xau:Xaut_0329)

MetaCyc: 54% identical to UDP-3-N-acyl-N-acetyl-alpha-3-amino-3-deoxy-D-glucosamine deacetylase (Brucella abortus 2308)
RXN2B4Q-49 [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF2254 UDP-3-O-acyl-N-acetylglucosamine deacetylase (Xanthobacter sp. DMC5)
MQTTLAREIALKGVGVHAGVEATITLKPASANTGVVFIRSFADQAPRKATVSRRSVQATD
LATVLGDRSGALVSTVEHVLAALSGLGVDNATVEIDGPEVPILDGSAGDFVAAIDAAGVA
EVRGRRKFLKVLKPVRVENGASFGELLPYEAGFRLEVEIEFGHDLIGRQRFAATMSPAVF
RRELAPARTFGFLKDVERLRSAGYARGAALENTVCLDESGVLNPDGLRFSDEFVRHKALD
AVGDLALAGMPLMARYRSFRGGHKLNFQVVDALLADRANYAIVEAPVRPVRDTVGAEIGV
SSPVPVFAPEI