Protein Info for GFF2253 in Xanthobacter sp. DMC5

Annotation: Outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 34 to 38 (5 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 29 to 262 (234 residues), 271.4 bits, see alignment E=3.4e-85 PF13512: TPR_18" amino acids 51 to 180 (130 residues), 33.1 bits, see alignment E=2.3e-11 PF13525: YfiO" amino acids 53 to 248 (196 residues), 163.7 bits, see alignment E=2e-51 PF13432: TPR_16" amino acids 60 to 127 (68 residues), 26.1 bits, see alignment E=3.8e-09 PF13174: TPR_6" amino acids 95 to 126 (32 residues), 17.7 bits, see alignment 1.8e-06 amino acids 131 to 171 (41 residues), 16.8 bits, see alignment 3.4e-06 amino acids 227 to 259 (33 residues), 17.3 bits, see alignment 2.5e-06

Best Hits

Swiss-Prot: 52% identical to BAMD_RHILO: Outer membrane protein assembly factor BamD (bamD) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K05807, putative lipoprotein (inferred from 91% identity to xau:Xaut_0330)

Predicted SEED Role

"competence lipoprotein ComL, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF2253 Outer membrane protein assembly factor BamD (Xanthobacter sp. DMC5)
MRFLNDVLPMRTLLRGAALASALVRGGMLVLALAMGLLVSGCASDKDDTIPPDEPAEKIY
NEGLTLLRRQEPEKAAKRFEDVDRAHPYSEWARKALLMTTYSYFEAGKYDEAIGVGKRYI
ALYPGSADAAYAQYLVASALYENIPDITRDQRKTRQALDALEAVVRKYPNTEYAATAKRK
IEVARDQLAGKEMAIGRYYLEQRNYTGAINRFKVVVTQYQTTRQVEEALYRLTECYMAMG
IVGEAQTAAAVLGYNFPDSSWYKDAYKLVQSGGAEPQENKASWISQAFKKMGLG