Protein Info for GFF225 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 209 to 377 (169 residues), 151.6 bits, see alignment E=8.3e-49 PF00990: GGDEF" amino acids 213 to 373 (161 residues), 130.9 bits, see alignment E=1.9e-42

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF225 hypothetical protein (Xanthobacter sp. DMC5)
MDFQVQTVLSVSAVVGLLLAGLQLLAGWRLRQSCVFVWSLANLFLTAGCVFLAARVDIGL
PASVLVGNGCILIGMGLIYSGIRVFDERPPGLAAVATVALLGTGLLGLSLWSGNNMADRV
TISSILVGCWSATAGRALLQTPGCGPIISRVASAIVLIMVAAGYTIRGVGVQFGLLPLPG
NGGPAEVLVVIAGLGLAICWTFGSLYMVLEKVASLDDLTGLLNRRAALQRGEELLRFARA
RRQPLSLLLADLDHFKSVNDRFGHDVGDLALKHFAGLVPQSIRANDVAGRYGGEEFCILL
PGAEAKGAFATAERLRLLVEEQLRDIGGHDIGVTLTVGAATYIPGSAGPDTIADLIIAAD
GALYAGKALGRNRTVIAQPPAGEAASAPRELPGHGVIAAEPSR