Protein Info for GFF2235 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Aldose-ketose isomerase YihS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to SQUS_SALTY: Sulfoquinovose isomerase (yihS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to seg:SG3404)

MetaCyc: 92% identical to sulfoquinovose isomerase (Escherichia coli K-12 substr. MG1655)
Mannose isomerase. [EC: 5.3.1.7]; RXN-15296 [EC: 5.3.1.7, 5.3.1.31]

Predicted SEED Role

"Aldose-ketose isomerase YihS"

MetaCyc Pathways

sulfoquinovose degradation I (4/5 steps found)
sulfoquinovose degradation VI (3/5 steps found)
sulfoquinovose degradation III (1/4 steps found)
sulfoquinovose degradation V (3/7 steps found)

KEGG Metabolic Maps

Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.31 or 5.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF2235 Aldose-ketose isomerase YihS (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKWFNTLSHNRWLEQETDRIFNFGKNAVVPTGFGWLGNKGQIKEEMGTHLWITARMLHVY
SVAASMGRPGAYDLVDHGIKAMNGALRDKKYGGWYACVNDQGVVDASKQGYQHFFALLGA
ASAVTTGHPEARKLLDYTIEVIEKYFWSEEEQMCLESWDEAFSQTEDYRGGNANMHAVEA
FLIVYDVTHDKKWLDRALRIASVIIHDVARNGDYRVNEHFDSQWNPIRDYNKDNPAHRFR
AYGGTPGHWIEWGRLMLHLHAALEARFETPPAWLLEDAKGLFHATIRDAWAPDGADGFVY
SVDWDGKPIVRERVRWPIVEAMGTAYALYTLTDDSQYEEWYQKWWDYCIKYLMDYENGSW
WQELDADNKVTTKVWDGKQDIYHLLHCLVIPRLPLAPGLAPAVAAGLLDINAK