Protein Info for PS417_11380 in Pseudomonas simiae WCS417

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13145: Rotamase_2" amino acids 140 to 273 (134 residues), 52.3 bits, see alignment E=1.6e-17 PF13616: Rotamase_3" amino acids 163 to 260 (98 residues), 62.7 bits, see alignment E=7.4e-21 PF00639: Rotamase" amino acids 172 to 258 (87 residues), 70.3 bits, see alignment E=3.4e-23

Best Hits

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 95% identity to pfs:PFLU2440)

Predicted SEED Role

"Putative PpiC-type peptidyl-prolyl cis-trans isomerase precursor associated with VreARI signaling system"

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5I2 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PS417_11380 peptidylprolyl isomerase (Pseudomonas simiae WCS417)
MKKPTLMVGAGALALLVVAVGLSLRPGSDPVAAQQPAPVLNPVSTGPAVARLGNQQIDLT
ELKTVLASLPAESREQLRGNRSALETWIRSRLAQKAVLEQADAQGWRQRPDVEQQTRAAA
EQIVFRDYMLSVSQVPADYPSAAELQLAYDSGKAQWVTPPLYQVSQIFLATHDPQTVDSV
RRQAQELSRRAQAAPADFAALATQFSQDTDSAARGGDSGMQPLQQLVPEVRSAVSRLKVG
AVSDVVQSAAGFHVLKLTGQQPARTATLDELRERLTQALRAQRQEQIAKAYLEGMLNTAT
LSIDGAELNKVLE