Protein Info for GFF2229 in Variovorax sp. SCN45

Annotation: Pca regulon regulatory protein PcaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR02431: beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family" amino acids 15 to 261 (247 residues), 334.9 bits, see alignment E=1.3e-104 PF09339: HTH_IclR" amino acids 22 to 71 (50 residues), 43.1 bits, see alignment 3e-15 PF01614: IclR_C" amino acids 86 to 259 (174 residues), 151.8 bits, see alignment E=1.6e-48

Best Hits

Swiss-Prot: 41% identical to PCAR_PSEPU: Pca regulon regulatory protein (pcaR) from Pseudomonas putida

KEGG orthology group: K02624, IclR family transcriptional regulator, pca regulon regulatory protein (inferred from 90% identity to vap:Vapar_4436)

Predicted SEED Role

"Pca regulon regulatory protein PcaR" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF2229 Pca regulon regulatory protein PcaR (Variovorax sp. SCN45)
MATHATQPAAPAPGDSYVQSFARGLQVIRSFSANAPHQTLSEVAAVSGLTRAGARRILLT
LQTLGYVVTDGKLFTLTPRILDLGFAYLSSMPIWNRAEPVMEALVQQVQESCSAAVLDAT
DIVYVLRVPTKKIMHINLGVGSRLPAYCTSLGRLLLADLPDDEVRARLEASEIEALTKHT
VTDIDALMAKVAQARKQQWCLVNQELEEGLVSVAAPIVDRQGRMVAALNISGQANRTSAK
AMQETMLPALRESADRISRML