Protein Info for GFF2229 in Sphingobium sp. HT1-2

Annotation: Mannonate dehydratase (EC 4.2.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF02746: MR_MLE_N" amino acids 15 to 111 (97 residues), 111 bits, see alignment E=3.9e-36 PF13378: MR_MLE_C" amino acids 134 to 378 (245 residues), 162.6 bits, see alignment E=1.2e-51

Best Hits

Swiss-Prot: 91% identical to MAND_SPHSS: D-mannonate dehydratase (SKA58_08619) from Sphingomonas sp. (strain SKA58)

KEGG orthology group: K08323, starvation sensing protein RspA (inferred from 90% identity to sjp:SJA_C2-03440)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF2229 Mannonate dehydratase (EC 4.2.1.8) (Sphingobium sp. HT1-2)
MPKITGAKVIVTCPGRNFVTLKIETEEGVYGLGDATLNGRELSVASYLQDHVIPCLIGRD
AHQIEDIWQYLYKGAYWRRGPVTMSAIAAVDTALWDIKGKIAGLPVYQLLGGASRESVMV
YGHANGTTIEDTVKVALEYQAQGYKAIRIQCGVPGMASTYGVSKDKYFYEPADADLPTEN
VWNTSKYLRIVPELFKAAREALGWDVHLLHDIHHRLTPIEAGRLGKDLEQYRPFWLEDAT
PAENQDAFKLIRQHTTTPLAVGEIFNSIHDCRELIQNQLIDYIRATVVHAGGISHLRKIA
NLADLYQVRTGCHGATDLSPVCMAAALHFDLSVPNFGVQEYMRHTPETDAVFPHAYTFEN
GAMHPGDKPGLGVDIDEELAAKYEYNRAFLPVNRLEDGTMFNW