Protein Info for GFF2227 in Variovorax sp. SCN45

Annotation: Tricarboxylate transport protein TctC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03401: TctC" amino acids 59 to 326 (268 residues), 143 bits, see alignment E=7.1e-46

Best Hits

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_4438)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>GFF2227 Tricarboxylate transport protein TctC (Variovorax sp. SCN45)
LTITKRRLLEGGAAAVAASLLAKASWAQQRNNNGGDAWPTKPLHILVGFPAGASPDLAAR
AIAEPLSKILRQPVTVENKPGASGNTVADLVAKATDDHTIGALINGNLTIAKLLNPSLPF
DPEKDFAPVGLIGTAPLVLAVSGSATGKTAADQLLWVRNLGSGGKYGTPGVGTVGHLGME
LIKSRAAITAQHKPYTGNPQVIAGLLANEIQLALLPPGLAMPHIKSGKIKAIGVTSPERS
PLASELPTIRDADVRGADLEIWTALAAPASMKPSAVARLNAALVEVISSPEVSQALLKTG
WQAQPGSPDTLAKRMRADTTRLGGVILMKGIHSEG