Protein Info for GFF2226 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Hypothetical radical SAM family enzyme in interesting gene cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF04055: Radical_SAM" amino acids 43 to 212 (170 residues), 62.2 bits, see alignment E=7.1e-21 PF06969: HemN_C" amino acids 327 to 392 (66 residues), 36.9 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 100% identity to set:SEN3799)

Predicted SEED Role

"Hypothetical radical SAM family enzyme in interesting gene cluster"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF2226 Hypothetical radical SAM family enzyme in interesting gene cluster (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNNNDIYRQYMYSYPHKTAYRELENVSFSEVKPRIYEHDTHLYVHMPFCQSRCGFCNLFT
CTGADNTFIDSYIDAIITQGRQMALAPAHWASFTVGGGTPLLLNIAQLEKLFFSVFDVLN
VDWNIYKTIETSPTDTTAEKVALLNAFSVNRVSIGVQSFHDSELHTLHRRHNAASAHQAL
EWLKAGHFPSLNIDIIYGIPGQTHASLTESLHQALVYQPEELFLYPLYNMPRQENMHSYY
VLARDLLRNAGYTQTSMRRFVLNPAPSAAAESCGFENSLALGAGGRSYLGNLHYCSPWSS
NLQTSRKIIQAFIDSPDKTVINHGYLLPPDEMKRRFIIKNLFFWQGLSLSDYQQYFASDA
LRDFPDLERFIRQGYCYQNGSRLRLTETGMALSDCLAPVFVSPEVMLRENRQR