Protein Info for GFF2225 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 254 to 283 (30 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 295 (244 residues), 136.4 bits, see alignment E=5.4e-44

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 92% identity to vap:Vapar_6137)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF2225 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MNRMTNMPPSLIAVERATAASRAALATGIALVLVAASLPWWGESSWMREFVEIACYFIFA
MMWNLLAGYGGMVSIGQQAFFGFGGYVMLMLGNFAGVNPFLAIPLGALAAGLVAIPVSFV
AFRLSGGYFAIGTWVIAEVFRLSFANVSAVGGGSGTTLTALRGIEKAMRESTTYWMALAC
VVAAVALVYLFLRSKRGLALLAIRDNEVAAESQGIPVARMKLAVYVVAALGAGLAGALYF
VGNLRISPDAAFSVNWTAFAIFMVVIGGIGRIEGPLVGALIFWALNKFLSDYGTWYLLGL
GLLAILVTLFFKQGLWGYAQQRWGWSLFPTQRKLLHATAGAKASSRG