Protein Info for GFF2222 in Sphingobium sp. HT1-2

Annotation: PutR, transcriptional activator of PutA and PutP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF13404: HTH_AsnC-type" amino acids 10 to 51 (42 residues), 59.7 bits, see alignment E=2.9e-20 PF13412: HTH_24" amino acids 10 to 57 (48 residues), 60.8 bits, see alignment E=1.1e-20 PF01037: AsnC_trans_reg" amino acids 77 to 150 (74 residues), 71.4 bits, see alignment E=7.2e-24

Best Hits

Swiss-Prot: 66% identical to PUTR_RHIRD: Proline dehydrogenase transcriptional activator (putR) from Rhizobium radiobacter

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 84% identity to sjp:SJA_C1-12960)

Predicted SEED Role

"PutR, transcriptional activator of PutA and PutP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF2222 PutR, transcriptional activator of PutA and PutP (Sphingobium sp. HT1-2)
MSNKPAMVEMDEFDRRIIAALVEDGRMTVTDLAASVGLSKTPCQVRLKRLQESGVIRGFR
AIVDPAKLGMDHVAFTEVKLSDTRESALREFNAAVRRIPEVEECHMLASNFDYLLKVRTS
DIRRYRMVLGEKISALPHVASTSTFVAMETVLESGSKRPRR