Protein Info for GFF2218 in Xanthobacter sp. DMC5

Annotation: Inner membrane transport permease YhhJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 235 to 260 (26 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 23 to 381 (359 residues), 75 bits, see alignment E=1.3e-24 PF12698: ABC2_membrane_3" amino acids 39 to 377 (339 residues), 124.1 bits, see alignment E=1.4e-39 PF01061: ABC2_membrane" amino acids 181 to 349 (169 residues), 92.5 bits, see alignment E=5.6e-30 PF12730: ABC2_membrane_4" amino acids 192 to 304 (113 residues), 27.1 bits, see alignment E=8.1e-10

Best Hits

Swiss-Prot: 52% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 86% identity to xau:Xaut_0209)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF2218 Inner membrane transport permease YhhJ (Xanthobacter sp. DMC5)
MAAPAPSAKAPSPRRLPLGNVRWLVGKELLGLWRDRALLVLVVYAFTLAIVLQANGMKHD
LNRAAVAVVDEDNSALSNAILDALLPPSFQRPMPIAPQDVDPMMDAARYTFVLNFPPNFQ
ADVLAGRSPEVQLLIDATALMQAGLGANDISAIFQTEVNRFVLRHSEGVASPVNLQIRAA
FNQGLESSWFTGTMGLITNITMLSVLLAGAALIREREHGTLEHLLVLPVRPSEIMLAKVV
ANGAVILVATLVSLVAVLKWVLGVSIAGSIPLFLAGAALYLFFTASLGIFLGTLAGSMPQ
FGLLFFLVVLPMNMLSGGFTPLESMPQWLQVTMQASPSTQFVAFAQAILYRGAGLETVWP
RFAATFGIGALFFAVALARFRTFLAAQQ