Protein Info for PS417_11310 in Pseudomonas simiae WCS417

Annotation: alkaline phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF12849: PBP_like_2" amino acids 26 to 246 (221 residues), 85.5 bits, see alignment E=2.8e-28

Best Hits

Swiss-Prot: 71% identical to PPBL_PSEAB: Alkaline phosphatase L (phoA2) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: None (inferred from 76% identity to pfs:PFLU2427)

Predicted SEED Role

"Phosphate-binding DING protein (related to PstS)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2N4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>PS417_11310 alkaline phosphatase (Pseudomonas simiae WCS417)
MFKRNVLAVSVTLAALCSAQAAMADINGGGATLPQPLYQTAGVLTTGFAPYIGVGSGNGK
SAFLNNDYTKFVAGVTNKNVHWAGSDSKLSATELSTYASTKQPAWGKLIQVPSVATSVAI
PFNKAGTNAVDLSVDQLCGVFSGRLTTWNQITNSGRTGPIALVYRSESSGTTELFTRFLN
AKCTEAQPFAVTTTFSSSYGGGLPSTAVAATGSQGVMDALNAVEGRITYMSPDYAATTLA
GLDDATKVAKVGGVSPAPANVSAAIGLVPAPTEARADGSFIDATNPDNWVPVFAATASGP
ATFAYPSSGYPILGFTNLIFSQCYADATQTTQVRSFFARHYGAFGNNDTAISNNRFVPLP
ANWKKAVRDTFATASNAQGIGNTSVCNAIGRPL