Protein Info for GFF2218 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: [NiFe] hydrogenase nickel incorporation protein HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 PF01155: HypA" amino acids 1 to 111 (111 residues), 101.2 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 72% identical to HYPA_POLNA: Hydrogenase maturation factor HypA (hypA) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 84% identity to rme:Rmet_1286)

MetaCyc: 31% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>GFF2218 [NiFe] hydrogenase nickel incorporation protein HypA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHEASLAGGVLQLVEDTAAREGFQRLLALRLEAGQLAGVDVRALRFALEALAPGTLLEGA
AIEIEEPPGQAWCLGCSQTVALAQRGDACPACGSFHLQPTGGAELRVLDMQVADD