Protein Info for GFF2217 in Xanthobacter sp. DMC5

Annotation: Ribosome-associated ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 909 transmembrane" amino acids 561 to 580 (20 residues), see Phobius details amino acids 714 to 737 (24 residues), see Phobius details amino acids 765 to 786 (22 residues), see Phobius details amino acids 793 to 814 (22 residues), see Phobius details amino acids 822 to 841 (20 residues), see Phobius details amino acids 852 to 870 (19 residues), see Phobius details amino acids 882 to 904 (23 residues), see Phobius details PF00005: ABC_tran" amino acids 29 to 176 (148 residues), 100.7 bits, see alignment E=2.2e-32 amino acids 292 to 436 (145 residues), 102.3 bits, see alignment E=6.7e-33 PF12698: ABC2_membrane_3" amino acids 563 to 902 (340 residues), 120 bits, see alignment E=2.7e-38 PF01061: ABC2_membrane" amino acids 712 to 871 (160 residues), 41.2 bits, see alignment E=2.8e-14

Best Hits

KEGG orthology group: K13926, ribosome-dependent ATPase (inferred from 86% identity to xau:Xaut_0210)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (909 amino acids)

>GFF2217 Ribosome-associated ATPase (Xanthobacter sp. DMC5)
VSEAAPAARPDAVRLSGIRHAYGRTQAVDGVDLAIQEGSAVALVGPDGVGKSTLLGLIAG
AKRIQTGGVEVLGADFASRKAREEAQPRIAFMPQGLGRNLYPNLSVAENIAFFARLFGED
AATKGARVAPLLAATGLDPFADRLMRKLSGGMKQKLGLCCALVHDPDLLLLDEPTTGVDP
LSRRQFWDFVDTIRADRPHLTLLVATADMEEAARFGRVVLMDQGRILADGSPAEHLARTG
QPTLERAFIALLPEGQRGDGEAVLPVAAIPADAPVAIESRGLTRRFGDFVAVNDVSFTIR
RGEIFGFLGSNGCGKSTTMKMLTGLLPASSGEALLFGVPVDPKDIETRRRVGYMSQAFSL
YGELTVRQNLELHARLFSLPEDAAAKRIADLVATFDLKDHLDALSDGLPLGVRQRLSLAV
AVLHEPEVLILDEPTSGVDPVARDGFWDHLQRLSRDEGVTIFVSTHFMGEAERCDRISFM
HAGRVIATGTPQALKEAQHATSLEEAFVAYMEMGGRAAGTEARLPPPQPRPAGRPSAFSP
RRLAAYAWRETLELKRDPVRLAFALLGTAFLMIIFGYGITLDVDRLRFAVLDRDQTPESR
AYIDGFAHSTYFRIQPPLTSPDDLDRRLKSNAIAFAIELPPSFGADLRSGRQTEVLVTID
GAMPFRAETIKGYVEAVHTLFLADAAQAAGRAYSAFAGLEMRYRYNQSFRSLDAMVPANI
ALMLIFIPAILTALGVVTEKELGSITNLYVTPVTKLEFLLGKQAPYVGVALFNFVVMVLM
ALFLFGVPLKGSFLGLALGAFAYVLATTAIGLVSSTLTNTQVAALFGTAIGTMMPATQFS
GMLQPVTSLEGGGWVLGTFFPTTYFMRVSVGAFTKGLSFTELLPFIMATAAFWPALLAIA
FLILRKQET